MON1A Rabbit Polyclonal Antibody

CAT#: TA342959

Rabbit Polyclonal Anti-MON1A Antibody

Product Images

WB Suggested Anti-MON1A Antibody; Titration: 1.0 ug/ml; Positive Control: PANC1 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MON1A antibody: synthetic peptide directed towards the C terminal of human MON1A. Synthetic peptide located within the following region: GIPDLRHFLYKSKSSGLFTSPEIEAPYTSEEEQERLLGLYQYLHSRAHNA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: MON1 homolog A, secretory trafficking associated
• Database Link:
  NP_001135973
  Entrez Gene 84315 Human
  UniProt ID Q86VX9
• Background: MON1A plays an important in membrane trafficking through the secretory apparatus. Not involved in endocytic trafficking to lysosomes.
• Synonyms: SAND1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Bovine: 93%; Zebrafish