RAB34 Rabbit Polyclonal Antibody

CAT#: TA342992

Rabbit Polyclonal Anti-RAB34 Antibody

Product Images

RAB34 antibody validated by WB using HepG2 cell lysate at 1 ug/ml.

• 

  Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug); 2. Monkey Fibroblast Cell Lysate (15ug); Primary Dilution: 1:1000; Secondary Antibody: goat anti-Rabbit; Secondary Dilution: 1:40,000; Image Submitted by: Dr. Jakob Szwedo, Dr. Lupashin's Lab; Univ

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAB34 antibody: synthetic peptide directed towards the C terminal of human RAB34. Synthetic peptide located within the following region: FFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: RAB34, member RAS oncogene family
• Database Link:
  NP_114140
  Entrez Gene 19376 MouseEntrez Gene 83871 Human
  UniProt ID P0DI83
• Background: RAB proteins, like RAB34, are small GTPases that regulate vesicle budding, docking, and fusion along endocytosis and exocytosis pathways.
• Synonyms: RAB39; RAH
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Mouse: 92%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome