D aspartate oxidase (DDO) Rabbit Polyclonal Antibody
Other products for "DDO"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DDO antibody: synthetic peptide directed towards the C terminal of human DDO. Synthetic peptide located within the following region: RDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 34 kDa |
Gene Name | D-aspartate oxidase |
Database Link | |
Background | The protein encoded by this gene is a peroxisomal flavoprotein that catalyzes the oxidative deamination of D-aspartate and N-methyl D-aspartate. Flavin adenine dinucleotide or 6-hydroxyflavin adenine dinucleotide can serve as the cofactor in this reaction. Two transcript variants encoding different isoforms have been found for this gene. |
Synonyms | DASOX; DDO-1; DDO-2 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86% |
Reference Data | |
Protein Pathways | Alanine, aspartate and glutamate metabolism |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.