Shugoshin (SGO1) Rabbit Polyclonal Antibody

CAT#: TA343161

Rabbit Polyclonal Anti-SGOL1 Antibody

Product Images

WB Suggested Anti-SGOL1 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SGOL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SGOL1. Synthetic peptide located within the following region: NSDRPVTRPLAKRALKYTDEKETEGSKPTKTPTTTPPETQQSPHLSLKDI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: shugoshin 1
• Database Link:
  NP_001012409
  Entrez Gene 151648 Human
  UniProt ID Q5FBB7
• Background: The function of this protein remains unknown.
• Synonyms: CAID; NY-BR-85; SGO; SGOL1
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 91%; Rat: 79%

Reference Data

• Protein Pathways: Oocyte meiosis