PKN2 Rabbit Polyclonal Antibody

CAT#: TA343178

Rabbit Polyclonal Anti-PKN2 Antibody

Product Images

Host: Rabbit; Target Name: Pkn2; Sample Tissue: Mouse Thymus lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Pkn2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Pkn2. Synthetic peptide located within the following region: LRRNPERRLGAGEKDAEDVKKHPFFRLTDWSALMDKKVKPPFVPTIRGRE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 111 kDa
• Gene Name: protein kinase N2
• Database Link:
  NP_006247
  Entrez Gene 109333 Mouse
  UniProt ID Q16513
• Background: Pkn2 is a PKC-related serine/threonine-protein kinase and Rho/Rac effector protein that participates in specific signal transduction responses in the cell. It plays a role in the regulation of cell cycle progression, actin cytoskeleton assembly, cell migration, cell adhesion, tumor cell invasion and transcription activation signaling processes. Pkn2 phosphorylates CTTN in hyaluronan-induced astrocytes and hence decreases CTTN ability to associate with filamentous actin, phosphorylates HDAC5, therefore lead to impair HDAC5 import. It is a direct RhoA target required for the regulation of the maturation of primordial junctions into apical junction formation in bronchial epithelial cells and is required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. It stimulates FYN kinase activity that is required for establishment of skin cell-cell adhesion during keratinocytes differentiation, regulates epithelial bladder cells speed and direction of movement during cell migration and tumor cell invasion, inhibits Akt pro-survival-induced kinase activity. It mediates Rho protein-induced transcriptional activation via the c-fos serum response factor (SRF).
• Synonyms: Pak-2; PAK2; PRK2; PRKCL2; PRO2042; STK7
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%; Yeast

Reference Data

• Protein Families: Druggable Genome, Protein Kinase