Calneuron 1 (CALN1) Rabbit Polyclonal Antibody

CAT#: TA343217

Rabbit Polyclonal Anti-CALN1 Antibody

Product Images

WB Suggested Anti-CALN1 Antibody; Titration: 1.0 ug/ml; Positive Control: COLO205 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CALN1 antibody is: synthetic peptide directed towards the N-terminal region of Human CALN1. Synthetic peptide located within the following region: PGEGKPENEKKGDGGALGGGEEPPRSQAPDFPTWEKMPFHHVTAGLLYKG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: calneuron 1
• Database Link:
  NP_113656
  Entrez Gene 83698 Human
  UniProt ID Q9BXU9
• Background: This gene encodes a protein with high similarity to the calcium-binding proteins of the calmodulin family. The encoded protein contains two EF-hand domains and potential calcium-binding sites. Alternative splicing results in multiple transcript variants.
• Synonyms: CABP8
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Guinea pig: 92%; Bovine: 91%; Rat: 83%; Mouse: 83%

Reference Data

• Protein Families: Transmembrane