SLAMF1 Rabbit Polyclonal Antibody

CAT#: TA343233

Rabbit Polyclonal Anti-SLAMF1 Antibody

Product Images

Host: Rabbit; Target Name: Slamf1; Sample Tissue: Mouse Spleen lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Slamf1 antibody is: synthetic peptide directed towards the middle region of Mouse Slamf1. Synthetic peptide located within the following region: QVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: signaling lymphocytic activation molecule family member 1
• Database Link:
  NP_003028
  Entrez Gene 27218 Mouse
  UniProt ID Q13291
• Background: Slamf1 is a high-affinity self-ligand important in bidirectional T-cell to B-cell stimulation. SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another in which protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates.
• Synonyms: CD150; CDw150; SLAM
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rat: 93%; Mouse: 87%; Dog: 85%; Horse: 85%; Rabbit: 80%; Guinea pig: 80%; Goat; Sheep; Bovine

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transmembrane