C10orf97 (FAM188A) Rabbit Polyclonal Antibody

CAT#: TA343239

Rabbit Polyclonal Anti-FAM188A Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "MINDY3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Fam188a antibody is: synthetic peptide directed towards the N-terminal region of Rat Fam188a. Synthetic peptide located within the following region: CAVIAPVQAFLLKKLLFSSEKSSWRDCSEDEQKELLCHTLCDILESACDS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 48 kDa
Gene Name family with sequence similarity 188 member A
Background The function of this protein remaining unknown.
Synonyms C10orf97; CARP; DERP5; MST126; MSTP126; my042
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.