Solute carrier family 22 member 5 (SLC22A5) Rabbit Polyclonal Antibody

CAT#: TA343308

Rabbit Polyclonal Anti-SLC22A5 Antibody

Product Images

WB Suggested Anti-SLC22A5 Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole Cell SLC22A5 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC22A5 antibody is: synthetic peptide directed towards the C-terminal region of SLC22A5. Synthetic peptide located within the following region: TLFLPESFGTPLPDTIDQMLRVKGMKHRKTPSHTRMLKDGQERPTILKST
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: solute carrier family 22 member 5
• Database Link:
  NP_003051
  Entrez Gene 6584 Human
  UniProt ID O76082
• Background: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is a plasma integral membrane protein which functions both as an organic cation transporter and as a sodium-dependent high affinity carnitine transporter. The encoded protein is involved in the active cellular uptake of carnitine. Mutations in this gene are the cause of systemic primary carnitine deficiency (CDSP), an autosomal recessive disorder manifested early in life by hypoketotic hypoglycemia and acute metabolic decompensation, and later in life by skeletal myopathy or cardiomyopathy.
• Synonyms: CDSP; OCTN2
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Horse: 86%; Pig: 79%; Bovine: 79%; Guinea pig: 79%; Mouse

Reference Data

• Protein Families: Transmembrane