ABI3 Rabbit Polyclonal Antibody

CAT#: TA343319

Rabbit Polyclonal Anti-ABI3 Antibody

Product Images

Host: Rabbit; Target Name: Abi3; Sample Tissue: Mouse Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Abi3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Abi3. Synthetic peptide located within the following region: DEPSWVPASYLEKVVTLYPYTRQKDNELSFSEGTVICVTRRYSDGWCEGV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: ABI family member 3
• Database Link:
  NP_057512
  Entrez Gene 66610 Mouse
  UniProt ID Q9P2A4
• Background: Abi3 inhibits ectopic tumor cell metastasis of SRD cells. In vitro, It reduces cell motility.
• Synonyms: NESH; SSH3BP3
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 92%