BARX2 Rabbit Polyclonal Antibody
Other products for "BARX2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-BARX2 antibody: synthetic peptide directed towards the N terminal of human BARX2. Synthetic peptide located within the following region: HCHAELRLSSPGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 31 kDa |
Gene Name | BARX homeobox 2 |
Database Link | |
Background | BARX2 is a member of the homeobox transcription factor family. A highly related protein in mouse has been shown to influence cellular processes that control cell adhesion and remodeling of the actin cytoskeleton in myoblast fusion and chondrogenesis. The protein may also play a role in cancer progression.This gene encodes a member of the homeobox transcription factor family. A highly related protein in mouse has been shown to influence cellular processes that control cell adhesion and remodeling of the actin cytoskeleton in myoblast fusion and chondrogenesis. The encoded protein may also play a role in cancer progression. |
Synonyms | MGC133368; MGC133369 |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.