Ciao1 Rabbit Polyclonal Antibody

CAT#: TA343486

Rabbit Polyclonal Anti-Ciao1 Antibody

Product Images

WB Suggested Anti-Ciao1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Ciao1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ciao1. Synthetic peptide located within the following region: MKDSLVLQSRVPAHPDSRCWFLAWNPSGTLLASCGGDRKIRIWGTEGDSW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: cytosolic iron-sulfur protein assembly 1
• Database Link:
  NP_079572
  Entrez Gene 26371 Mouse
  UniProt ID Q99KN2
• Background: Ciao1 is an essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. It is required for the maturation of extramitochondrial Fe/S proteins. Seems to specifically modulate the transactivation activity of WT1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation.
• Synonyms: CIA1; WDR39
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Zebrafish: 86%; Pig: 79%; Bovine: 79%