CDKN1A interacting zinc finger protein 1 (CIZ1) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of CDKN1A interacting zinc finger protein 1 (CIZ1), transcript variant 1
USD 605.00
Other products for "CIZ1"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CIZ1 antibody: synthetic peptide directed towards the C terminal of human CIZ1. Synthetic peptide located within the following region: YKAAKNPSPTTRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 100 kDa |
Gene Name | CDKN1A interacting zinc finger protein 1 |
Database Link | |
Background | CIZ1 may regulate the subcellular localization of CIP/WAF1. |
Synonyms | LSFR1; NP94; ZNF356 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.