SART3 Rabbit Polyclonal Antibody

CAT#: TA343750

Rabbit Polyclonal Anti-SART3 Antibody

Product Images

WB Suggested Anti-SART3 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate; SART3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Human Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SART3 antibody: synthetic peptide directed towards the N terminal of human SART3. Synthetic peptide located within the following region: TSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: squamous cell carcinoma antigen recognized by T-cells 3
• Database Link:
  NP_055521
  Entrez Gene 9733 Human
  UniProt ID Q15020
• Background: SART3 is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. SART3 is found to be an important cellular factor for HIV-1 gene expression and viral replication. It also associates transiently with U6 and U4/U6 snRNPs during the recycling phase of the spliceosome cycle. This protein is thought to be involved in the regulation of mRNA splicing.
• Synonyms: DSAP1; P100; p110; p110(nrb); RP11-13G14; TIP110
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 79%; Horse: 79%; Guinea pig: 79%; Dog: 77%