Calcipressin 3 (RCAN3) Rabbit Polyclonal Antibody

CAT#: TA343794

Rabbit Polyclonal Anti-RCAN3 Antibody

Product Images

transfected HEK293

• 

  WB Suggested Anti-RCAN3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RCAN3 antibody: synthetic peptide directed towards the middle region of human RCAN3. Synthetic peptide located within the following region: PGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTRRPDPPTA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: RCAN family member 3
• Database Link:
  NP_038469
  Entrez Gene 11123 Human
  UniProt ID Q9UKA8
• Background: RCAN3 inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. It could play a role during central nervous system development.
• Synonyms: DSCR1L2; hRCN3; MCIP3; RCN3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 77%