Pumilio 2 (PUM2) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of pumilio homolog 2 (Drosophila) (PUM2)
USD 396.00
Other products for "PUM2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PUM2 antibody: synthetic peptide directed towards the N terminal of human PUM2. Synthetic peptide located within the following region: MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAW |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 114 kDa |
Gene Name | pumilio RNA binding family member 2 |
Database Link | |
Background | PUM2 is a sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3' UTR of mRNA targets. Its interactions and tissue specificity suggest that it may be required to support proliferation and self-renewal of stem cells by regulating the translation of key transcripts. |
Synonyms | PUMH2; PUML2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.