TRNT1 Rabbit Polyclonal Antibody

CAT#: TA343834

Rabbit Polyclonal Anti-TRNT1 Antibody


USD 410.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human tRNA nucleotidyl transferase, CCA-adding, 1 (TRNT1), transcript variant 1
    • 20 ug

USD 823.00


Transient overexpression lysate of tRNA nucleotidyl transferase, CCA-adding, 1 (TRNT1), transcript variant 1
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "TRNT1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TRNT1 antibody: synthetic peptide directed towards the N terminal of human TRNT1. Synthetic peptide located within the following region: PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 45 kDa
Gene Name tRNA nucleotidyl transferase 1
Background TRNT1 belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. It adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates.
Synonyms 1; CCA-adding; CCA1; CGI-47; mitochondrial CCA-adding tRNA-nucleotidyltransferase; MtCCA; tRNA nucleotidyl transferase
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 93%; Rabbit: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.