Apolipoprotein O (APOO) Rabbit Polyclonal Antibody

CAT#: TA343926

Rabbit Polyclonal Anti-FAM121B Antibody


USD 410.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human apolipoprotein O (APOO), transcript variant 1
    • 20 ug

USD 823.00


Transient overexpression lysate of apolipoprotein O (APOO), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "APOO"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FAM121B antibody: synthetic peptide directed towards the C terminal of human FAM121B. Synthetic peptide located within the following region: LYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 22 kDa
Gene Name apolipoprotein O
Background FAM121B belongs to the FAM121 family and the function remains unknown.
Synonyms FAM121B; Mic23; MIC26; My025
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 93%; Mouse: 93%; Pig: 86%; Rat: 86%; Bovine: 86%
Reference Data
Protein Families Secreted Protein, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.