Apolipoprotein O (APOO) Rabbit Polyclonal Antibody

CAT#: TA343927

Rabbit Polyclonal Anti-FAM121B Antibody

Product Images

WB Suggested Anti-FAM121B Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FAM121B antibody: synthetic peptide directed towards the N terminal of human FAM121B. Synthetic peptide located within the following region: PASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: apolipoprotein O
• Database Link:
  NP_077027
  Entrez Gene 79135 Human
  UniProt ID Q9BUR5
• Background: FAM121B belongs to the FAM121 family and the function remains unknown.
• Synonyms: FAM121B; Mic23; MIC26; My025
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Horse: 85%; Rabbit: 79%

Reference Data

• Protein Families: Secreted Protein, Transmembrane