RBM4B Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human RNA binding motif protein 4B (RBM4B)
USD 823.00
Transient overexpression lysate of RNA binding motif protein 4B (RBM4B)
USD 396.00
Other products for "RBM4B"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RBM4B antibody: synthetic peptide directed towards the C terminal of human RBM4B. Synthetic peptide located within the following region: AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 39 kDa |
Gene Name | RNA binding motif protein 4B |
Database Link | |
Background | RBM4B contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing. |
Synonyms | RBM4L; RBM30; ZCCHC15; ZCCHC21B; ZCRB3B |
Note | Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 86%; Goat: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.