MFRP Rabbit Polyclonal Antibody

CAT#: TA344083

Rabbit Polyclonal Anti-MFRP Antibody

Product Images

WB Suggested Anti-MFRP Antibody Titration: 0.2-1 ug/ml; Positive Control: Human kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MFRP antibody: synthetic peptide directed towards the N terminal of human MFRP. Synthetic peptide located within the following region: TCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: membrane frizzled-related protein
• Database Link:
  NP_113621
  Entrez Gene 83552 Human
  UniProt ID Q9BY79
• Background: MFRP is a member of the frizzled-related proteins. It may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen. The protein i
• Synonyms: MCOP5; NNO2; RD6
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane