Plexin A4 (PLXNA4) Rabbit Polyclonal Antibody

CAT#: TA344306

Rabbit Polyclonal Anti-PLXNA4 Antibody - middle region

Product Images

WB Suggested Anti-PLXNA4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PLXNA4 antibody: synthetic peptide directed towards the middle region of human PLXNA4. Synthetic peptide located within the following region: TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: plexin A4
• Database Link:
  NP_861440
  Entrez Gene 91584 Human
  UniProt ID Q9HCM2
• Background: This protein mediates semaphorin receptor activity.
• Synonyms: FAYV2820; PLEXA4; PLXNA4A; PLXNA4B; PRO34003
• Note: Immunogen Sequence Homology: Human: 100%; Yeast: 90%

Reference Data

• Protein Families: Druggable Genome