MS4A4A Rabbit Polyclonal Antibody

CAT#: TA344314

Rabbit Polyclonal Anti-MS4A4A Antibody - N-terminal region


USD 475.00

2 Weeks*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of membrane-spanning 4-domains, subfamily A, member 4 (MS4A4A), transcript variant 2
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "MS4A4A"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MS4A4A antibody: synthetic peptide directed towards the N terminal of human MS4A4A. Synthetic peptide located within the following region: MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name membrane spanning 4-domains A4A
Background MS4A4A is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. Alternative splicing of this gene results in several transcript variants; however, not all transcripts have been fully described.
Synonyms 4SPAN1; CD20-L1; CD20L1; HDCME31P; MS4A4; MS4A7
Note Immunogen Sequence Homology: Human: 100%; Rat: 86%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.