NPM2 Rabbit Polyclonal Antibody

CAT#: TA344382

Rabbit Polyclonal Anti-NPM2 Antibody - N-terminal region

Product Images

WB Suggested Anti-NPM2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NPM2 antibody: synthetic peptide directed towards the N terminal of human NPM2. Synthetic peptide located within the following region: LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: nucleophosmin/nucleoplasmin 2
• Database Link:
  NP_877724
  Entrez Gene 10361 Human
  UniProt ID Q86SE8
• Background: NPM2 belongs to the nucleoplasmin family. It probably involved in sperm DNA decondensation during fertilization.
• Synonyms: MGC78655
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 77%