C2orf3 (GCFC2) Rabbit Polyclonal Antibody

CAT#: TA344465

Rabbit Polyclonal Anti-C2orf3 Antibody - N-terminal region

Product Images

WB Suggested Anti-C2orf3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Human Lung

• 

  Host: Rabbit; Target Name: GCFC2; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: GCFC2; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml; GCFC2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C2orf3 antibody: synthetic peptide directed towards the N terminal of human C2orf3. Synthetic peptide located within the following region: SEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQEDEKQDTWEQQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 89 kDa
• Gene Name: GC-rich sequence DNA-binding factor 2
• Database Link:
  NP_003194
  Entrez Gene 6936 Human
  UniProt ID P16383
• Background: The first mRNA transcript isolated for C2orf3 gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). C2orf3 belongs to the GCF family. It is a factor that represses transcription. It binds to the GC-rich sequences (5'-GCGGGGC-3') present in the epidermal growth factor receptor, beta-actin, and calcium-dependent protease promoters.The first mRNA transcript isolated for this gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). A positively charged amino terminus present only in the chimera was determined to bind GC-rich DNA, thus mistakenly thought to identify a transcription factor gene.
• Synonyms: C2orf3; DNABF; GCF; TCF9
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Horse: 85%; Mouse: 85%; Rabbit: 83%; Bovine: 79%

Reference Data

• Protein Families: Transcription Factors