POU2F3 Rabbit Polyclonal Antibody

CAT#: TA344503

Rabbit Polyclonal Anti-POU2F3 Antibody - C-terminal region

Product Images

Host: Rabbit; Target Name: POU2F3; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-POU2F3 antibody is: synthetic peptide directed towards the C-terminal region of Human POU2F3. Synthetic peptide located within the following region: LSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: POU class 2 homeobox 3
• Database Link:
  NP_055167
  Entrez Gene 25833 Human
  UniProt ID Q9UKI9
• Background: The function of this protein remains unknown.
• Synonyms: Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Sheep: 93%; Guinea pig: 93%; Bovine: 92%