PRSS22 Rabbit Polyclonal Antibody

CAT#: TA344696

Rabbit Polyclonal Anti-PRSS22 Antibody - N-terminal region

Product Images

WB Suggested Anti-PRSS22 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRSS22 antibody: synthetic peptide directed towards the N terminal of human PRSS22. Synthetic peptide located within the following region: IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: protease, serine 22
• Database Link:
  NP_071402
  Entrez Gene 64063 Human
  UniProt ID Q9GZN4
• Background: This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.
• Synonyms: BSSP-4; hBSSP-4; SP001LA
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 91%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein