HAPLN2 Rabbit Polyclonal Antibody

CAT#: TA344718

Rabbit Polyclonal Anti-HAPLN2 Antibody - middle region

Product Images

WB Suggested Anti-HAPLN2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HAPLN2 antibody: synthetic peptide directed towards the middle region of human HAPLN2. Synthetic peptide located within the following region: LDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: hyaluronan and proteoglycan link protein 2
• Database Link:
  NP_068589
  Entrez Gene 60484 Human
  UniProt ID Q9GZV7
• Background: HAPLN2 mediates a firm binding of versican V2 to hyaluronic acid.HAPLN2 may play a pivotal role in the formation of the hyaluronan-associated matrix in the central nervous system (CNS) which facilitates neuronal conduction and general structural stabilization. HAPLN2 binds to hyaluronic acid.
• Synonyms: BRAL1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 77%

Reference Data

• Protein Families: Secreted Protein