HMG20A Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of high-mobility group 20A (HMG20A)
USD 396.00
Other products for "HMG20A"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the N terminal of human HMG20A. Synthetic peptide located within the following region: ENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPEF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 40 kDa |
Gene Name | high mobility group 20A |
Database Link | |
Background | HMG20A plays a role in neuronal differentiation as chromatin-associated protein. It overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. The protein also act as inhibitor of HMG20B. It involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4. |
Synonyms | HMGX1; HMGXB1 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Bovine: 92%; Rabbit: 85% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.