SLC2A4RG Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of SLC2A4 regulator (SLC2A4RG)
USD 396.00
Other products for "SLC2A4RG"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SLC2A4RG antibody is: synthetic peptide directed towards the C-terminal region of Human SLC2A4RG. Synthetic peptide located within the following region: HSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTLRKPRGDAKKCRKV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 29 kDa |
Gene Name | SLC2A4 regulator |
Database Link | |
Background | The protein encoded by SLC2A4RG is a nuclear transcription factor involved in the activation of the solute carrier family 2 member 4 gene. The encoded protein interacts with another transcription factor, myocyte enhancer factor 2, to activate transcription of this gene. |
Synonyms | GEF; HDBP-1; HDBP1; Si-1-2; Si-1-2-19 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 85%; Mouse: 83% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.