SLC2A4RG Rabbit Polyclonal Antibody

CAT#: TA345276

Rabbit Polyclonal Anti-SLC2A4RG Antibody

Product Images

Host: Rabbit; Target Name: SLC2A4RG; Sample Tissue: Thymus Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC2A4RG antibody is: synthetic peptide directed towards the C-terminal region of Human SLC2A4RG. Synthetic peptide located within the following region: HSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTLRKPRGDAKKCRKV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: SLC2A4 regulator
• Database Link:
  NP_064446
  Entrez Gene 56731 Human
  UniProt ID Q9NR83
• Background: The protein encoded by SLC2A4RG is a nuclear transcription factor involved in the activation of the solute carrier family 2 member 4 gene. The encoded protein interacts with another transcription factor, myocyte enhancer factor 2, to activate transcription of this gene.
• Synonyms: GEF; HDBP-1; HDBP1; Si-1-2; Si-1-2-19
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 85%; Mouse: 83%

Reference Data

• Protein Families: Transcription Factors