Deformed Epidermal Autoregulatory Factor 1 (DEAF1) Rabbit Polyclonal Antibody

CAT#: TA345315

Rabbit Polyclonal Anti-DEAF1 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "DEAF1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DEAF1 antibody: synthetic peptide directed towards the C terminal of human DEAF1. Synthetic peptide located within the following region: TGCHKVNYCSTFCQRKDWKDHQHICGQSAAVTVQADEVHVAESVMEKVTV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 59 kDa
Gene Name DEAF1, transcription factor
Background DEAF1 down-regulates transcription of those genes by binding to sequence with multiple copies of TTC[CG]G present in their own promoter and that of the HNRPA2B1 gene. DEAF1 binds to the retinoic acid response element (RARE) AGGGTTCACCGAAAGTTCA. DEAF1 activates the proenkephalin gene independently of promoter binding, probably through protein-protein interaction. When secreted, behaves as an inhibitor of cell proliferation, by arresting cells in the G0 or G1 phase.
Synonyms MRD24; NUDR; SPN; ZMYND5
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Dog: 86%; Horse: 86%; Rat: 79%; Mouse: 79%; Guinea pig: 79%
Reference Data
Protein Families Secreted Protein, Transcription Factors, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.