Deformed Epidermal Autoregulatory Factor 1 (DEAF1) Rabbit Polyclonal Antibody

CAT#: TA345315

Rabbit Polyclonal Anti-DEAF1 Antibody

Product Images

WB Suggested Anti-DEAF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate; DEAF1 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DEAF1 antibody: synthetic peptide directed towards the C terminal of human DEAF1. Synthetic peptide located within the following region: TGCHKVNYCSTFCQRKDWKDHQHICGQSAAVTVQADEVHVAESVMEKVTV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: DEAF1, transcription factor
• Database Link:
  NP_066288
  Entrez Gene 10522 Human
  UniProt ID O75398
• Background: DEAF1 down-regulates transcription of those genes by binding to sequence with multiple copies of TTC[CG]G present in their own promoter and that of the HNRPA2B1 gene. DEAF1 binds to the retinoic acid response element (RARE) AGGGTTCACCGAAAGTTCA. DEAF1 activates the proenkephalin gene independently of promoter binding, probably through protein-protein interaction. When secreted, behaves as an inhibitor of cell proliferation, by arresting cells in the G0 or G1 phase.
• Synonyms: MRD24; NUDR; SPN; ZMYND5
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Dog: 86%; Horse: 86%; Rat: 79%; Mouse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Secreted Protein, Transcription Factors, Transmembrane