TRIM14 Rabbit Polyclonal Antibody

CAT#: TA345475

Rabbit Polyclonal Anti-TRIM14 Antibody

Product Images

WB Suggested Anti-TRIM14 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the middle region of human TRIM14. Synthetic peptide located within the following region: LSFEPVKSFFKGLVEAVESTLQTPLDIRLSPTNHAYSALKVSSPRLVSNR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: tripartite motif containing 14
• Database Link:
  NP_150090
  Entrez Gene 9830 Human
  UniProt ID Q14142
• Background: TRIM14 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been de
• Synonyms: KIAA0129; OTTHUMP00000021761; OTTHUMP00000021762; OTTHUMP00000021763; OTTHUMP00000021764; tripartite motif-containing 14; tripartite motif protein 14; tripartite motif protein TRIM14
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome