Taf1c Rabbit Polyclonal Antibody

CAT#: TA345646

Rabbit Polyclonal Anti-Taf1c Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "Taf1c"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Taf1c antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RRHRGETSETQTQSKRPKRRTQLSSTFSSFTSYLDSPDASSAPRSQDLST
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 92 kDa
Gene Name TATA-box binding protein associated factor, RNA polymerase I, C
Background Taf1c is a component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits. Taf1c recruits RNA polymerase I to the rRNA gene promoter via interaction with RRN3.
Synonyms MGC:39976; SL1; TAFI95; TAFI110
Note Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Pig: 85%; Guinea pig: 85%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.