Deleted in azoospermia 4 (DAZ4) Rabbit Polyclonal Antibody

CAT#: TA345709

Rabbit Polyclonal Anti-DAZ4 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Purified recombinant protein of Homo sapiens deleted in azoospermia 4 (DAZ4), transcript variant 2
    • 20 ug

USD 823.00


Transient overexpression lysate of deleted in azoospermia 4 (DAZ4), transcript variant 2
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "DAZ4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DAZ4 antibody: synthetic peptide directed towards the middle region of human DAZ4. Synthetic peptide located within the following region: ITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 44 kDa
Gene Name deleted in azoospermia 4
Background This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.
Synonyms pDP1680; pDP1681
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Goat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.