PRKRA Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1
USD 823.00
Transient overexpression lysate of protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1
USD 396.00
Other products for "PRKRA"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PRKRA antibody: synthetic peptide directed towards the N terminal of human PRKRA. Synthetic peptide located within the following region: MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 34 kDa |
Gene Name | protein activator of interferon induced protein kinase EIF2AK2 |
Database Link | |
Background | PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA). |
Synonyms | DYT16; HSD14; PACT; RAX |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 86%; Guinea pig: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.