HNRPAB (HNRNPAB) Rabbit Polyclonal Antibody

CAT#: TA345873

Rabbit Polyclonal Anti-HNRPAB Antibody

Product Images

WB Suggested Anti-HNRPAB Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: COLO205 cell lysateHNRNPAB is supported by BioGPS gene expression data to be expressed in COLO205

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HNRPAB antibody: synthetic peptide directed towards the N terminal of human HNRPAB. Synthetic peptide located within the following region: GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: heterogeneous nuclear ribonucleoprotein A/B
• Database Link:
  NP_112556
  Entrez Gene 3182 Human
  UniProt ID Q99729
• Background: This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes. They are associated with pr
• Synonyms: ABBP1; HNRPAB
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rat: 93%; Dog: 86%; Bovine: 86%