NXF1 Rabbit Polyclonal Antibody

CAT#: TA345955

Rabbit Polyclonal Anti-NXF1 Antibody

Product Images

WB Suggested Anti-NXF1 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysateNXF1 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Lanes: Lane 1: 7ug HeLa lysate+EGFP SiRNA; Lane 2: 7ug HeLa lysate+NXF1 SiRNA; Primary Antibody Dilution: 1: 300; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1: 500; Gene Name: NXF1; Submitted by: Seiji Masuda, Kitashirakawa Oiwakecho, Kyoto University; NXF1 is supported by BioGPS gene expression data to be expressed in HeLa

• 

  Rabbit Anti-NXF1Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NXF1 antibody: synthetic peptide directed towards the N terminal of human NXF1. Synthetic peptide located within the following region: MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: nuclear RNA export factor 1
• Database Link:
  NP_006353
  Entrez Gene 10482 Human
  UniProt ID Q9UBU9
• Background: NXF1 is one member of a family of nuclear RNA export factor. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF1 shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ RNA. NXF1 overcomes the mRNA export block caused by the presence of saturating amounts of CTE (constitutive transport element) RNA of type D retroviruses.This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. The encoded protein of this gene shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ RNA. It is the vertebrate homologue of the yeast protein Mex67p. The encoded protein overcomes the mRNA export block caused by the presence of saturating amounts of CTE (constitutive transport element) RNA of type D retroviruses.
• Synonyms: MEX67; TAP
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Mouse: 92%; Bovine: 92%; Guinea pig: 92%; Dog: 83%