PDZK1 Rabbit Polyclonal Antibody

CAT#: TA346092

Rabbit Polyclonal Anti-PDZK1 Antibody

Product Images

WB Suggested Anti-PDZK1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysatePDZK1 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PDZK1 antibody: synthetic peptide directed towards the N terminal of human PDZK1. Synthetic peptide located within the following region: NSVTLLVLDGDSYEKAVKTRVDLKELGQSQKEQGLSDNILSPVMNGGVQT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: PDZ domain containing 1
• Database Link:
  NP_002605
  Entrez Gene 5174 Human
  UniProt ID Q5T2W1
• Background: PDZK1 is a scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. It may be involved in the coordination of a diverse range of regulatory processes for ion transport and second messenger cascades. In complex with SLC9A3R1, it may cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking and the activity of the associated membrane proteins. PDZK1 may play a role in the cellular mechanisms associated with multidrug resistance through its interaction with ABCC2 and PDZK1IP1. PDZK1 may potentiate the CFTR chloride channel activity. It may function to connect SCARB1 with the cellular machineries for intracellular cholesterol transport and/or metabolism. PDZK1 may be involved in the regulation of proximal tubular Na+-dependent inorganic phosphate cotransport therefore playing an important role in tubule function.
• Synonyms: CAP70; CLAMP; NHERF-3; NHERF3; PDZD1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Bovine: 92%; Rabbit: 92%