RAGE (AGER) Rabbit Polyclonal Antibody

CAT#: TA346144

Rabbit Polyclonal Anti-AGER Antibody

Product Images

WB Suggested Anti-AGER Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Rabbit Anti-AGER Antibody; Paraffin Embedded Tissue: Human Lung; Cellular Data: Alveolar cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AGER antibody: synthetic peptide directed towards the C terminal of human AGER. Synthetic peptide located within the following region: PSPQIHWMKDVSDLERGAGRTRRGGANCRLCGRIRAGNSSPGPGDPGRPG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: advanced glycosylation end product-specific receptor
• Database Link:
  NP_751947
  Entrez Gene 177 Human
  UniProt ID Q15109
• Background: AGER mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. It is receptor for amyloid beta peptide.This gene encodes a member of the immunoglobulin superfamily of cell surface molecules. It is a receptor for various molecules, including the amyloidogenic form of serum amyloid A, amyloid-beta protein, members of the S100/calgranulin superfamily and advanced glycation end products. The gene lies within the major histocompatibility complex (MHC) class III region on chromosome 6. Alternative splicing results in two transcript variants encoding different isoforms.This gene encodes a member of the immunoglobulin superfamily of cell surface molecules. It is a receptor for various molecules, including the amyloidogenic form of serum amyloid A, amyloid-beta protein, members of the S100/calgranulin superfamily and advanced glycation end products. The gene lies within the major histocompatibility complex (MHC) class III region on chromosome 6. Alternative splicing results in two transcript variants encoding different isoforms.
• Synonyms: RAGE
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane