SPRR3 Rabbit Polyclonal Antibody

CAT#: TA346406

Rabbit Polyclonal Anti-SPRR3 Antibody

Product Images

WB Suggested Anti-SPRR3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPRR3 antibody: synthetic peptide directed towards the middle region of human SPRR3. Synthetic peptide located within the following region: DQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: small proline rich protein 3
• Database Link:
  NP_005407
  Entrez Gene 6707 Human
  UniProt ID Q9UBC9
• Background: SPRR3 is the cross-linked envelope protein of keratinocytes.
• Synonyms: esophagin; OTTHUMP00000015757; small proline-rich protein 3
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 92%; Mouse: 86%; Bovine: 86%; Rabbit: 85%; Pig: 79%