EIF3E Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human eukaryotic translation initiation factor 3, subunit E (EIF3E)
USD 823.00
Transient overexpression lysate of eukaryotic translation initiation factor 3, subunit E (EIF3E)
USD 396.00
Other products for "EIF3E"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human, Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EIF3E antibody: synthetic peptide directed towards the middle region of human EIF3E. Synthetic peptide located within the following region: LNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 52 kDa |
Gene Name | eukaryotic translation initiation factor 3 subunit E |
Database Link | |
Background | EIF3E belongs to the eIF-3 subunit E family.It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. EIF3E is required for nonsense-mediated mRNA decay (NMD); It may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. The protein may interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins. |
Synonyms | eIF3-p46; EIF3-P48; EIF3S6; INT6 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.