PCID1 (EIF3M) Rabbit Polyclonal Antibody

CAT#: TA346606

Rabbit Polyclonal Anti-EIF3M Antibody

Product Images

WB Suggested Anti-EIF3M Antibody Titration: 1.0 ug/ml; Positive Control: HepG2 cell lysate.There is BioGPS gene expression data showing that EIF3M is expressed in HepG2

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF3M antibody: synthetic peptide directed towards the N terminal of human EIF3M. Synthetic peptide located within the following region: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: eukaryotic translation initiation factor 3 subunit M
• Database Link:
  NP_006351
  Entrez Gene 10480 Human
  UniProt ID Q7L2H7
• Background: This gene encodes a protein that is part of the eurkaryotic translation initiation factor 3 complete (eIF-3) required for protein synthesis. Elevated levels of the encoded protein are present in cancer cell lines. Inactivation of the encoded protein has been shown to interfere with translation of herpes virus mRNAs by preventing the association of mRNAs with the ribosomes. A pseudogene of this gene is located on the X chromosome. [provided by RefSeq, Dec 2011]
• Synonyms: B5; GA17; hfl-B5; PCID1; TANGO7
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%