PGCP (CPQ) Rabbit Polyclonal Antibody

CAT#: TA346623

Rabbit Polyclonal Anti-PGCP Antibody

Product Images

WB Suggested Anti-PGCP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PGCP antibody: synthetic peptide directed towards the N terminal of human PGCP. Synthetic peptide located within the following region: VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: carboxypeptidase Q
• Database Link:
  NP_057218
  Entrez Gene 10404 Human
  UniProt ID Q9Y646
• Background: This gene encodes a metallopeptidase that belongs to the peptidase M28 family. The encoded protein may catalyze the cleavage of dipeptides with unsubstituted terminals into amino acids. [provided by RefSeq, Jul 2013]
• Synonyms: LDP; PGCP
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Dog: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Protease