Nidogen 2 (NID2) Rabbit Polyclonal Antibody

CAT#: TA346763

Rabbit Polyclonal Anti-NID2 Antibody

Product Images

WB Suggested Anti-NID2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NID2 antibody: synthetic peptide directed towards the middle region of human NID2. Synthetic peptide located within the following region: DDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 148 kDa
• Gene Name: nidogen 2
• Database Link:
  NP_031387
  Entrez Gene 22795 Human
  UniProt ID Q14112
• Background: This gene encodes a member of the nidogen family of basement membrane proteins. This protein is a cell-adhesion protein that binds collagens I and IV and laminin and may be involved in maintaining the structure of the basement membrane. [provided by RefSeq, Jun 2010]
• Synonyms: NID-2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 93%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein