CMAS Rabbit Polyclonal Antibody

CAT#: TA346802

Rabbit Polyclonal Anti-CMAS Antibody

Product Images

WB Suggested Anti-CMAS Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CMAS antibody: synthetic peptide directed towards the N terminal of human CMAS. Synthetic peptide located within the following region: GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: cytidine monophosphate N-acetylneuraminic acid synthetase
• Database Link:
  NP_061156
  Entrez Gene 55907 Human
  UniProt ID Q8NFW8
• Background: Sialic acids are a family of nine-carbon sugars on cell surface glycoproteins and glycolipids that play a pivotal role in determining the structure and function of many animal tissues. The pattern of cell surface sialylation is highly regulated during embryonic development and N-glycosylation is a common post-translational modification during cellular differentiation. Sialic acids play important roles in cell-cell communications and immune responses. Sialylated glycoprotein and glycolipid formation requires the activation of a sialic acid to a cytidine monophosphate (CMP) diester by the enzyme encoded by this gene: CMP-N-acetylneuraminic acid synthetase. [provided by RefSeq, Jul 2012]
• Synonyms: CSS
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 93%

Reference Data

• Protein Pathways: Amino sugar and nucleotide sugar metabolism, Metabolic pathways