PRTFDC1 Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human phosphoribosyl transferase domain containing 1 (PRTFDC1)
USD 823.00
Transient overexpression lysate of phosphoribosyl transferase domain containing 1 (PRTFDC1)
USD 396.00
Other products for "PRTFDC1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PRTFDC1 antibody: synthetic peptide directed towards the middle region of human PRTFDC1. Synthetic peptide located within the following region: MKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 26 kDa |
Gene Name | phosphoribosyl transferase domain containing 1 |
Database Link | |
Background | Has low, barely detectable phosphoribosyltransferase activity (in vitro). Binds GMP, IMP and alpha-D-5-phosphoribosyl 1-pyrophosphate (PRPP). Is not expected to contribute to purine metabolism or GMP salvage. |
Synonyms | HHGP |
Note | Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Dog: 92%; Rat: 92%; Rabbit: 77%; Zebrafish: 77% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.