Mt2 (NM_008630) Mouse Tagged ORF Clone

CAT#: MR200037

Mt2 (Myc-DDK-tagged) - Mouse metallothionein 2 (Mt2)

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Mt2
• Synonyms: AA409533; Mt-2; MT-II
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR200037 representing NM_008630
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGACCCCAACTGCTCCTGTGCCTCCGATGGATCCTGCTCCTGTGCTGGCGCCTGCAAATGCAAACAAT
  GCAAATGTACTTCCTGCAAGAAAAGCTGCTGCTCCTGCTGCCCCGTGGGCTGTGCGAAGTGCTCCCAGGG
  CTGCATCTGCAAAGAGGCTTCCGACAAGTGCAGCTGCTGTGCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR200037 representing NM_008630
  Red=Cloning site Green=Tags(s)
  
  MDPNCSCASDGSCSCAGACKCKQCKCTSCKKSCCSCCPVGCAKCSQGCICKEASDKCSCCA
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_008630
• ORF Size: 183 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_008630.1, NM_008630.2, NP_032656.1
• RefSeq Size: 556
• RefSeq ORF: 186
• Locus ID: 17750
• MW: 6.6 kDa
• Gene Summary: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. [UniProtKB/Swiss-Prot Function]