Gimap4 (BC005577) Mouse Tagged ORF Clone

CAT#: MR202489

  • TrueORF®

Gimap4 (Myc-DDK-tagged) - Mouse GTPase, IMAP family member 4 (cDNA clone MGC:11734 IMAGE:3968418)


  "BC005577" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 68.00

USD 310.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Gimap4"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Gimap4
Synonyms MGC11734, IMAP4, mIAN1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR202489 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGTCCAGTGCGGTGGTGCGGGGTTCATCCCAGAAAGTTCAAGGAGCAGCCATGAGCTTGGAAACC
AAGATCAAGGAATTCCCCAACTGAGAATTGTCTTACTTGGAAAAACTGGAGCAGGAAAGAGTTCAACAGG
GAACAGTATCCTTGGGGAAAAAGTGTTTAATTCTGGCATTTGTGCAAAATCCATCACCAAGGTCTGTGAA
AAAAGGGTGAGCACCTGGGATGGGAAAGAGCTTGTTGTCGTGGATACACCTGGTATTTTTGACACTGAGG
TACCAGATGCTGACACACAAAGGGAGATCACTCGCTATGTTGCCCTGACCTCTCCAGGGCCTCATGCTCT
GCTCCTGGTAGTTCCACTGGGGCGTTATACTGTGGAAGAACACAAGGCTACACAGAAAATTCTGGACATG
TTTGGAAAACAGGCTAGAAGATTCATGATTCTCTTGCTCACCAGGAAGGATGACTTAGAAGACACTGATA
TCCATGAGTACTTAGAGAAGGCTCCTAAATTCTTTCAAGAGGTGATGCATGAGTTCCAGAATCGCTACTG
TTTGTTCAACAACAGAGCCTCAGGCGCTGAAAAGGAAGAGCAGAAGATGCAATTGTTGACCTTGGTCCAG
AGCATGTTTCTGTCTTCCAGGATGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202489 protein sequence
Red=Cloning site Green=Tags(s)

MEVQCGGAGFIPESSRSSHELGNQDQGIPQLRIVLLGKTGAGKSSTGNSILGEKVFNSGICAKSITKVCE
KRVSTWDGKELVVVDTPGIFDTEVPDADTQREITRYVALTSPGPHALLLVVPLGRYTVEEHKATQKILDM
FGKQARRFMILLLTRKDDLEDTDIHEYLEKAPKFFQEVMHEFQNRYCLFNNRASGAEKEEQKMQLLTLVQ
SMFLSSRMK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC005577
ORF Size 657 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC005577, AAH05577
RefSeq Size 1364 bp
RefSeq ORF 659 bp
Locus ID 107526
MW 24.6 kDa
Gene Summary This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. This gene exists within a cluster of other related genes located on mouse chromosome 6. This family member encodes a lymphoid signaling protein that functions to accelerate programmed T-cell death, which appears to correlate with the phosphorylation status of the protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.