Sfrs7 (BC014857) Mouse Tagged ORF Clone

CAT#: MR202659

  • TrueORF®

Sfrs7 (Myc-DDK-tagged) - Mouse splicing factor, arginine/serine-rich 7 (cDNA clone MGC:6268 IMAGE:2646366)


  "BC014857" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 68.00

USD 670.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Sfrs7"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Sfrs7
Synonyms MGC38287, 9G8, NX-96, 35kDa
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR202659 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCACGCTACGGGCGGTATGGAGGAGAAACCAAGGTATATGTTGGTAACCTGGGAACTGGTGCTGGTA
AAGGAGAGTTAGAAAGGGCATTCAGTTACTATGGGCCCTTAAGAACTGTGTGGATTGCCAGAAATCCTCC
AGGATTCGCCTTTGTGGAATTTGAAGACCCTAGAGATGCAGAGGATGCAGTTCGAGGATTGGATGGGAAA
GTGATTTGTGGTTCTCGAGTGAGGGTTGAACTATCAACAGGCATGCCTCGGAGATCTCGTTTTGATAGGC
CACCTGCCCGTCGTCCCTTTGATCCTAATGATAGATGCTATGAGTGTGGTGAAAAGGGACATTATGCTTA
TGACTGTCATCGCTATAGCCGACGAAGAAGAAGCAGGTCACGATCTAGATCCCATTCCCGATCCAGGGGA
AGGCGATACTCTCGCTCCCGCAGCAGGAGCCGAGGACGGAGGTCAAGATCAGCATCTCCTCGCCGATCAA
GGTCTGTGTCTCTTCGTAGATCAAGATCAGCTTCACTCAGAAGATTTAGGTTTGGTTTTATAATAGGATC
GAGGTATTTCCAATCCCGCTCAAGGTCGAGATCAAGATCCAGGTTTATTTCACGACCAAGAAGCAGTTGT
TCCCCATCAGGAAGTCCCCCCAGAAGTGCAAGTCCAGAAAGAATGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202659 protein sequence
Red=Cloning site Green=Tags(s)

MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGK
VICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRG
RRYSRSRSRSRGRRSRSASPRRSRSVSLRRSRSASLRRFRFGFIIGSRYFQSRSRSRSRSRFISRPRSSC
SPSGSPPRSASPERMD

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC014857
ORF Size 678 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC014857, AAH14857
RefSeq Size 1045 bp
RefSeq ORF 680 bp
Locus ID 225027
MW 26.2 kDa
Gene Summary The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Five transcript variants, four of them protein-coding and the other not protein-coding, have been found for this gene. [provided by RefSeq, Sep 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.