Cytochrome b5 (CYB5A) (NM_148923) Human Tagged ORF Clone

CAT#: RC202378

CYB5A (Myc-DDK-tagged)-Human cytochrome b5 type A (microsomal) (CYB5A), transcript variant 1

Product Images

Western blot validation of overexpression lysate (Cat# LY403451) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC202378 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified CYB5A protein (Cat# TP302378). The protein was produced from HEK293T cells transfected with CYB5A cDNA clone (Cat# RC202378) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CYB5A
• Synonyms: CYB5; MCB5; METAG
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC202378 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCAGAGCAGTCGGACGAGGCCGTGAAGTACTACACCCTAGAGGAGATTCAGAAGCACAACCACAGCA
  AGAGCACCTGGCTGATCCTGCACCACAAGGTGTACGATTTGACCAAATTTCTGGAAGAGCATCCTGGTGG
  GGAAGAAGTTTTAAGGGAACAAGCTGGAGGTGACGCTACTGAGAACTTTGAGGATGTCGGGCACTCTACA
  GATGCCAGGGAAATGTCCAAAACATTCATCATTGGGGAGCTCCATCCAGATGACAGACCAAAGTTAAACA
  AGCCTCCGGAAACTCTTATCACTACTATTGATTCTAGTTCCAGTTGGTGGACCAACTGGGTGATCCCTGC
  CATCTCTGCAGTGGCCGTCGCCTTGATGTATCGCCTATACATGGCAGAGGAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC202378 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHST
  DAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_148923
• ORF Size: 402 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_148923.1, NM_148923.2, NM_148923.3, NP_683725.1
• RefSeq Size: 850 bp
• RefSeq ORF: 405 bp
• Locus ID: 1528
• Cytogenetics: 18q22.3
• Protein Families: Transmembrane
• MW: 15.3 kDa
• Gene Summary: 'The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]'